PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_07064.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 845aa    MW: 95686.8 Da    PI: 9.0099
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_07064.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM34.17.9e-111258148
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             lppGfrF Pt e  + +yL++kv+g++++l ++i+e+d+yk++P  Lp
  Sme2.5_07064.1_g00002.1 12 LPPGFRFYPTHEKRLFQYLCRKVAGDDFSL-QIIAEIDLYKFDPCVLP 58
                             79***************************9.89************998 PP

2NAM44.35.5e-145910185128
                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tg+dk ++s +g++vg+kk Lvfy g+apkg+kt+W+mh yrl
  Sme2.5_07064.1_g00002.1  59 TTGTDKVITS-QGRKVGIKKALVFYIGKAPKGTKTNWIMHKYRL 101
                              5899999999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100520.6231125IPR003441NAC domain
SuperFamilySSF1019411.96E-338125IPR003441NAC domain
PfamPF023651.1E-913101IPR003441NAC domain
SuperFamilySSF566727.03E-59543784No hitNo description
Gene3DG3DSA:3.10.10.102.3E-24549691No hitNo description
CDDcd016471.30E-42583702No hitNo description
CDDcd092746.27E-42697793No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MHKPDPLAKL SLPPGFRFYP THEKRLFQYL CRKVAGDDFS LQIIAEIDLY KFDPCVLPTT  60
GTDKVITSQG RKVGIKKALV FYIGKAPKGT KTNWIMHKYR LSEPSTKSGS SSRLDDWVLC  120
WIYKKNSNMQ KTCSSGLQSK EISHGSSSSL PSQFNGMLES LAIIEDQYFS LPTRSFQQDD  180
NKLNIQQQGC GNFDWTTLAG FNSFPKLTAR NQAPAHAYGS TDKLVFAPVR YWTDVAMTSL  240
RCITTTRKSY GSTDKLVFAP KIPSKRIVTQ RDDLAPAAEN AQLEVLLVAS RGNSQGPQAP  300
SSISPESSAT TRPRDFLRMN MLVYTRSKVE EDLPNFIDEM YKVLKGMHAN EIERVELASY  360
QLKDIVNVWY NQWEDSRDRL GTSNLSTRRG DEVKGTAEHS PPQHPQLAII RGVLLQDQED  420
TPDVVTSMFC VFTFDCYVLF DPGATLYSVT PYVAGKFGIL LECFLEPFVI STLTEWKGSS  480
VAPKGKFISY LRAKKFISKG CIYHLVRVKS DDAEFSTLES VPIVNEFPEV FLNDLPGVPP  540
DRKIEFGIDV LPKTQPISIP PYRMASAKLE ELNEQLKDLL EKGFIRPNVS SFGAPVLFMH  600
KKDGPIRMCI NYWQLLKVTI KNKYPLLSLY DLFDQLQGAT CFSKIDLRSS YHQLKVRESD  660
IPKTAFRTRY GHFEFLVMSF GLTNAPVSFM DLTNRIRKVI AYASRQLKIH KKNYLTHDLE  720
LMTVVFALKT WCHYLYGVHV DVFTNHKSLQ YIFSQKELNL RQKRWLDLLN DYDMSILYHP  780
GKANIVVDAL SRLSMGSTTD VEEGKRELAK EVHRLALLGV QLEENNEGGV NVQNGSASSL  840
VSGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-5511319174NAC domain-containing protein 19
3swm_B6e-5511319174NAC domain-containing protein 19
3swm_C6e-5511319174NAC domain-containing protein 19
3swm_D6e-5511319174NAC domain-containing protein 19
3swp_A6e-5511319174NAC domain-containing protein 19
3swp_B6e-5511319174NAC domain-containing protein 19
3swp_C6e-5511319174NAC domain-containing protein 19
3swp_D6e-5511319174NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.28e-65NAC family protein